PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G00630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 341aa    MW: 37649.1 Da    PI: 10.3451
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G00630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33.1e-32161214255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  OPUNC06G00630.1 161 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 214
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.36E-15158215IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28159214IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23161215IPR006447Myb domain, plants
PfamPF002492.1E-7162213IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MELFPRQLDL SLHISTPSCS SPSPASAPTT ATKQQMPEEE SAATTTSSRS APPLLPSNSD  60
ASATSTNHHG DGGLANLQHQ KQLKAAAMQP IHGVPVYHGR HQQQQQQRRQ LHQPYDVVGD  120
GGRRLFSHHV GVTPRMSSSS SSSPSRLLPR LPPGRRSVRA PRMRWTTTLH ARFVHAVELL  180
GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTIKNTDR PVSYAGQNND GFDNASAGDI  240
SDDSFTDGPL RQNKSMLASE QNDTNIYSGL WSNNSSGKVD HRLDLRLPIR EPANEIYRRY  300
LKNTKLSVDL ETSMLRLPGR PNLELGLGRL HNDTSAKSKH A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656560.11e-115PREDICTED: probable transcription factor KAN2
SwissprotQ9C6166e-50KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0E0L6X40.0A0A0E0L6X4_ORYPU; Uncharacterized protein
STRINGBGIOSGA022077-PA1e-175(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP174351111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.12e-46G2-like family protein